Align pimeloyl-CoA dehydrogenase small subunit (EC 1.3.1.62) (characterized)
to candidate WP_101588764.1 BJEO58_RS07090 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-20677 (380 letters) >NCBI__GCF_900169175.1:WP_101588764.1 Length = 386 Score = 323 bits (827), Expect = 6e-93 Identities = 185/388 (47%), Positives = 239/388 (61%), Gaps = 18/388 (4%) Query: 1 MDFDLSEEQRLLKESVEGLLKGSYDFDSRKKYAKEKGGWSRAVWGKFAEQGLLGLPFSEE 60 MD +L++EQR LK +V LL+ YD +R++ + + GWS W FAE GLLGLPFSE+ Sbjct: 1 MDLELTDEQRELKSTVARLLRTEYDAAAREEILRSEKGWSEEKWQTFAELGLLGLPFSED 60 Query: 61 DGGFGAGAVETMIVMEALGHSLVLEPYLPTVVIGGGFLRRAGSAAQKAAHLPGIIDGSKT 120 G G E +VME G +LVLEPYL TVV+GGG + AG+ QK LPG+I+G K Sbjct: 61 YDGADMGFAEVAVVMEEFGRALVLEPYLSTVVLGGGLVDAAGTPQQKQDILPGLIEGEKL 120 Query: 121 FAFAQLEKNSRWDLGDVSTTAKKSGDGWVIDGEKFVVLNGEAADTLIVTARTKGGQRDRT 180 AFA E SR+DL STTA SG G+ + GEK VL A T +V+A G Sbjct: 121 LAFAGYEPTSRYDLTAPSTTAADSGSGFAVSGEKSSVLGAADAHTFVVSAAVDG------ 174 Query: 181 GVGVFLVPADAKGITRKGYPTQDGLHAADITFTGVQVGADAAIGDPENALELIEAVVDDA 240 GVG+FLV ADA+G+T +G DG+ A + F A A +A +IE VVD A Sbjct: 175 GVGLFLVDADAQGVTVEGRMQADGIRAGSVVF----ADAPATRLGAGDASAVIERVVDTA 230 Query: 241 RTALCAEAVGLMDESLTTTVEYIKTRKQFGVPIGSFQVLQHRAADMFVATEQARSMAMFA 300 AL AEAVG M+ SLT T EY+KTR+QFG PIG QVLQHRAAD + E A+SMA++A Sbjct: 231 NAALAAEAVGAMEASLTMTAEYLKTREQFGAPIGVNQVLQHRAADAYATLESAKSMALYA 290 Query: 301 TMAAEFD--------DAKERAGAIAAAKVQIGKSGKFVGQQSIQLHGGIGMTMEAKIGHY 352 +A + D+K R + A+K+ I + + + Q+SIQ+HGGIGMTME IGHY Sbjct: 291 KLAITGEESADEGAGDSKSRHRDVLASKLIIDDASREISQESIQMHGGIGMTMEYPIGHY 350 Query: 353 FKRLTMIEQTFGDTDHHLARVSAGGGLI 380 KRLT+I +TF D D +++ GGLI Sbjct: 351 AKRLTVIPRTFDDVDTVSQELASLGGLI 378 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 386 Length adjustment: 30 Effective length of query: 350 Effective length of database: 356 Effective search space: 124600 Effective search space used: 124600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory