Align BadH (characterized)
to candidate WP_101590136.1 BJEO58_RS14305 (S)-acetoin forming diacetyl reductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_900169175.1:WP_101590136.1 Length = 261 Score = 154 bits (388), Expect = 2e-42 Identities = 97/261 (37%), Positives = 141/261 (54%), Gaps = 7/261 (2%) Query: 1 MARLQN-KTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEA 59 MAR N K A+I GGG GIG A R ++G K+AV D N A +VA ++ A A Sbjct: 1 MARQDNGKVALIIGGGQGIGRAAIERLHRDGFKVAVGDFNTVTANEVADSLGGKDNGAIA 60 Query: 60 VRCDIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGAL 119 V + DR SV AA+ TT + LG D+++NNAG +++++ +N+ G L Sbjct: 61 VEVNATDRDSVFAAVETTASELGGFDVIINNAGIAPQTSIEDATEADFDKIFDLNVKGVL 120 Query: 120 HMHHAVLPGMVERRH-GRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGI 178 A + E H G+I++ AS A G+ G +Y+A K + S+T AR+ A++GI Sbjct: 121 WGIQAATAKLKELGHGGKIISAASQAGHKGNKGIPLYSATKFAVRGMSQTAARDLAQYGI 180 Query: 179 TVNVVCPGPTDTALL----ADVTSGAANPEKL-IEAFTKAIPLGRLGKPDDLAGAIAFFG 233 TVN PG T L+ +V A PE+ E FT+ I L RL +P+D+A I+F Sbjct: 181 TVNTYAPGIVRTPLMENLAKEVAEAAGQPEEWGWEQFTQDITLDRLSEPEDVANVISFLA 240 Query: 234 SDDAGFITGQVLSVSGGLTMN 254 D+ +ITGQ + V GG+ N Sbjct: 241 GSDSDYITGQSIVVDGGMVFN 261 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 261 Length adjustment: 24 Effective length of query: 231 Effective length of database: 237 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory