Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_101588551.1 BJEO58_RS05940 AMP-binding protein
Query= BRENDA::D3GE78 (556 letters) >NCBI__GCF_900169175.1:WP_101588551.1 Length = 543 Score = 207 bits (527), Expect = 8e-58 Identities = 157/508 (30%), Positives = 243/508 (47%), Gaps = 36/508 (7%) Query: 58 LAAGLRKSGLQRGDRVLLFSGNDLFFPVVFLGVIMAGGIFTGANPTFVARELAYQLQDSG 117 LAA L +G+ GDRV L++ ND F V + V G + NP AREL Y L+DSG Sbjct: 51 LAASLVANGVAAGDRVALYTQNDPLFAVGVIAVWKLGAVGVPINPMNTARELRYHLRDSG 110 Query: 118 ATYLLCAS---NSLETGLEAAKQAKLPQSHIFAYDTSIYDGVTNPQKGCAYWSD------ 168 A L+ + + + A ++ F DG+ A + Sbjct: 111 AKALITLPTLWDDVAAEVIADSPVRVTVIGRFLRWQPDGDGIRVEAVAAAVGAARPAPDG 170 Query: 169 --LLASEE--EGAAFTWDELSTPALSSTTLAL-NYSSGTTGRPKGVEISHRNYVANMLQY 223 LL E+ GA PA S++ AL Y+SGTTG PKG +H N N Y Sbjct: 171 TVLLCLEDLPRGAPLA----DRPATSASDPALLTYTSGTTGSPKGAINTHGNLAFNAETY 226 Query: 224 CHTASLHPDYKARLERSRWLCFLPMYHAMAQNIFIAAALYRATPVYIMSKFDFVKMLEYT 283 L P L P++H +A + P+ + +F V ++E Sbjct: 227 VQIGGLEPGQPI-------LAVAPLFHITGSVGHLAYGIRAGCPLVLSHRFHPVAVVESI 279 Query: 284 QRFRITDFILVPPVVVALAKHPAVGQYDLSSVELVGSGAAPLGREVCEEVEKLWPPGKIN 343 +R+R I ++A+A P + DL+S+E+V +G AP+ + + +EK++ Sbjct: 280 RRWRPVFTIGAITALMAIADSPELRDGDLTSLEVVYTGGAPVAPTLSDRLEKVYGS---Y 336 Query: 344 IKQGWGMTEATCSVTGWNPAEIST------SASVGELNANCEAKIMFDGVEVKERNSRGE 397 I +GM+E +T E S S SVG + E +I+ D GE Sbjct: 337 IHSAYGMSETASPITVGPVGERSPVDPESGSLSVGRAVYDTELRIVDDAGTELPDGEYGE 396 Query: 398 LWVRAPNVMKGYWRNEKATKETKTEDGWLLTGDIAFVDDDGKFHVVDRMKELIKVKGNQV 457 +W R P + GYW+N++AT T+ G+L TGD+AF D +G ++VDR K++I G +V Sbjct: 397 IWARGPQITPGYWQNDEATAAEITDGGFLHTGDVAFRDAEGWIYLVDRKKDMINAAGYKV 456 Query: 458 APAELEALLLEHPAISDVAVIGVVIN-NDERPRAYVVLRPGQSATANEIAHYLDNKVSAF 516 P E+E +L +H A+S+ AV+GV + E AYV ++ GQS T E+ + +++A+ Sbjct: 457 WPREVEGVLYDHEAVSEAAVVGVADDYRGETVAAYVTVKTGQSVTEEELVAHCREQLAAY 516 Query: 517 KRITGGVVFLEAIPKNPSGKILRMKLRE 544 K I + L+ +PK +GKI+R LR+ Sbjct: 517 K-IPRSIGILDEMPKTATGKIMRRALRD 543 Lambda K H 0.319 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 722 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 543 Length adjustment: 36 Effective length of query: 520 Effective length of database: 507 Effective search space: 263640 Effective search space used: 263640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory