Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_101588405.1 BJEO58_RS05430 crotonase/enoyl-CoA hydratase family protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_900169175.1:WP_101588405.1 Length = 302 Score = 155 bits (393), Expect = 7e-43 Identities = 94/264 (35%), Positives = 148/264 (56%), Gaps = 8/264 (3%) Query: 4 ETIETKKEGNLFWITLNRPDKLNALNAK-LLEELDRAVSQAESDPEIRVIIITGKGKAFC 62 + + +++G++ TLNRPD N ++ ++ + AV A +DP +RV+I+TG GKAF Sbjct: 39 DALLVERDGHVETWTLNRPDSRNPISDDDMVAAIIDAVDAANADPAVRVVILTGAGKAFS 98 Query: 63 AGADITQFNQLT------PAEAWKFSKKG-REIMDKIEALSKPTIAMINGYALGGGLELA 115 AG D+ + + P + + G ++I ++ L P IA +NG A+G G +L Sbjct: 99 AGGDVKKMRDRSGMFGGHPHQMRGGYRYGIQQIPLALQRLDAPLIAAVNGPAVGAGCDLT 158 Query: 116 LACDIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKY 175 D+RIA+E A + LGI PG GG L R++G RA EM +TGDR+ K A ++ Sbjct: 159 AMADMRIASETAWFAESFVKLGIIPGDGGAWFLPRLVGPARAAEMTLTGDRVDAKTALEW 218 Query: 176 GLVNRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVV 235 GLV+RVV +L E R LA+++A P ++ + K+++ S L S L L + + Sbjct: 219 GLVSRVVAPEDLMTEARALADRVAVNPPHAVRMAKKLLKESDGSSLSSLLELSAAMQPLA 278 Query: 236 FSTEDKKEGVSAFLEKREPTFKGK 259 D E + AFL+KR+PTF G+ Sbjct: 279 HHAPDHAEAIDAFLDKRDPTFTGE 302 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 302 Length adjustment: 26 Effective length of query: 233 Effective length of database: 276 Effective search space: 64308 Effective search space used: 64308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory