Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate WP_101588658.1 BJEO58_RS06450 SDR family oxidoreductase
Query= CharProtDB::CH_091826 (259 letters) >NCBI__GCF_900169175.1:WP_101588658.1 Length = 263 Score = 102 bits (255), Expect = 6e-27 Identities = 83/254 (32%), Positives = 117/254 (46%), Gaps = 17/254 (6%) Query: 2 EQVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNESNANRLADTINSRYGAGRAYGFKVD 61 E+ AVV+G LG GLA AG HV ADLN A A I R G G A +D Sbjct: 15 ERTAVVVGSASGLGRATAVGLADAGAHVVCADLNTDGARETAQIIADRGGRGEAVA--LD 72 Query: 62 ATDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLCSR 121 T +VEA+A E F A +LV + G + +FD + +NL G + R Sbjct: 73 ITSTENVEAVA----EQFADAHVLVMTPGFNVRKTMAATTDAEFDRVIDINLKGTYRLMR 128 Query: 122 EFSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHS 181 F M G +G I+ S V Y+AAK G V LT++LA +L G+ V+S Sbjct: 129 AFGTRMAERG-RGSIVTFASFRALVIEPGQGLYAAAKAGVVQLTKTLASELGGSGVRVNS 187 Query: 182 LMLGNLLKSPMFQSLLPQYAEKLGITPEEVEPYYVDKVPLKRGCDYQDVLNVLLFYASDK 241 ++ G ++P+ + + E Y +K L R ++ +LF ASD Sbjct: 188 ILPGP-FETPLTEQIK---------ADREWWDAYAEKGTLGRWGVLHEIAGPVLFLASDA 237 Query: 242 AAYCTGQSINVTGG 255 ++Y TG S+ V GG Sbjct: 238 SSYVTGHSLLVDGG 251 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 263 Length adjustment: 25 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory