Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate WP_101588722.1 BJEO58_RS06825 glucose 1-dehydrogenase
Query= metacyc::MONOMER-13092 (266 letters) >NCBI__GCF_900169175.1:WP_101588722.1 Length = 259 Score = 120 bits (301), Expect = 3e-32 Identities = 83/266 (31%), Positives = 126/266 (47%), Gaps = 25/266 (9%) Query: 8 AGKTVIVTGASSGIGKAIVDELLSLKVKVANFDLTDNGEKHENLLFQKV----------D 57 +G+TVI+TGA SG+G+A L + D+ +G + + D Sbjct: 5 SGRTVIITGAGSGLGQATALRLAQEDANLVLVDMNADGLEETRTQVESAGAGGVELVTAD 64 Query: 58 VTSREQVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMIN 117 VT E V+ V A + FG+VD NNAGI + L + + D F K+ +N Sbjct: 65 VTKSEDVQKYVDAALTTFGSVDGFFNNAGIEGRQNLTE--------DFGDDEFAKVLAVN 116 Query: 118 QKGLYLVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELG 177 G++ AV + + + G I+N AS G+ G QS YA K V TR+ A+E G Sbjct: 117 LTGVFAGMAAVLKQMRRQGSGAIVNTASVGGIRGVGNQSGYAAAKHGVVGLTRNSAREYG 176 Query: 178 KYGVRVVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSEV 237 ++G+R+ IAPG + T E +L G+ E AG + P+ R GK EV Sbjct: 177 EHGIRINAIAPG-----AIMTAMVEGSLRQLGGEDWE--AAGEEFVSANPMKRFGKPEEV 229 Query: 238 ADLVAYYISDRSSYITGITTNVAGGK 263 A LV + +++ S +I G + GG+ Sbjct: 230 AALVTFLLAEESGFINGTVVPIDGGQ 255 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 259 Length adjustment: 25 Effective length of query: 241 Effective length of database: 234 Effective search space: 56394 Effective search space used: 56394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory