Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_101589331.1 BJEO58_RS10010 CoA transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_900169175.1:WP_101589331.1 Length = 220 Score = 196 bits (499), Expect = 2e-55 Identities = 103/200 (51%), Positives = 135/200 (67%), Gaps = 2/200 (1%) Query: 7 LSRTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGDK-EVFLHSENGLLGMGPSPAPGEE 65 L+R +MA R A ++ +G+YVNLGIG PTLV NY+ + V L SENGLLG+GP P E Sbjct: 3 LTRNQMAARAAEELADGSYVNLGIGMPTLVPNYIPEGVHVVLQSENGLLGVGPYPRRDEI 62 Query: 66 DDDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEG 125 D DLINAGK+ VT+ G AFF A SF M+RGG +D+A+LG QV+ GD+ANW + Sbjct: 63 DADLINAGKEIVTMHPGAAFFDSAVSFGMIRGGKIDVAILGGMQVAGNGDIANWMIPGK- 121 Query: 126 SIPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVT 185 + +GGAMDL GA++V V+MDH K G KL+ C PLTG VSRI TDLAVL+VT Sbjct: 122 MVKGMGGAMDLVHGAKKVLVLMDHTAKDGSLKLLEACDLPLTGERVVSRIITDLAVLDVT 181 Query: 186 PEGLKVVEICADIDFDELQK 205 G +++E + +E+Q+ Sbjct: 182 GTGFRLIERAPGVSVEEIQE 201 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 220 Length adjustment: 22 Effective length of query: 191 Effective length of database: 198 Effective search space: 37818 Effective search space used: 37818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory