Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_101588980.1 BJEO58_RS08110 acetyl-CoA C-acetyltransferase
Query= SwissProt::Q0KBP1 (394 letters) >NCBI__GCF_900169175.1:WP_101588980.1 Length = 413 Score = 345 bits (886), Expect = 1e-99 Identities = 188/403 (46%), Positives = 255/403 (63%), Gaps = 13/403 (3%) Query: 4 EVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEPR 63 ++V+ +R+ +G FGG KD+AP ELG VV + ++ + + + V+FG Sbjct: 10 DIVICEPLRSPVGAFGGQFKDIAPEELGRQVVTALIEKSGIRPEAIDDVIFGQCYPHMEA 69 Query: 64 DMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSRA 123 +GRV A++ G+ + P V+R CGSGLQA++ I G V + GGAESMSRA Sbjct: 70 PA-IGRVVALDSGLPVTVPGRQVDRRCGSGLQAVLDGMGAIATGGAQVVVAGGAESMSRA 128 Query: 124 PYLAPAARWGARMGDAGLVDMMLGALHDPFHRIH-----MGVTAENVAKEYDISRAQQDE 178 P+ RWG R G+ L D ++ + H M TAEN+ +EY I R +QD Sbjct: 129 PFFNEDIRWGIRGGNVELKDGLVRGRLTAGGKNHPVPGGMIETAENLREEYSIGREEQDR 188 Query: 179 AALESHRRASAAIKAGYFKDQIVPVV--SKGRKGDVTFDTDEHVRHDATIDDMTKLRPVF 236 A+ESHRRA+AA +G F ++I P+ + ++ + DEH+R A+++ + KL+ + Sbjct: 189 LAVESHRRATAATDSGVFAEEIAPITLPATRKQPEQQITLDEHIRPSASLESLGKLKAMR 248 Query: 237 VK--ENGTVTAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIGP 294 K EN TVTAGNASG ND AAA ++ RA+A+ GLKPL R+VS+G AGV P+ MGIGP Sbjct: 249 AKLDENSTVTAGNASGQNDGAAATIVTTRAKADELGLKPLVRIVSWGVAGVPPRTMGIGP 308 Query: 295 VPATKIALERAGLQVSDLDVIEANEAFAAQACAVTKALGL---DPAKVNPNGSGISLGHP 351 VPATK+ALERAGL++ DLD+IE NEAFAAQA AVT+ G D + N +GSGISLGHP Sbjct: 309 VPATKVALERAGLEIKDLDLIELNEAFAAQALAVTREWGFGESDFERTNVHGSGISLGHP 368 Query: 352 IGATGALITVKALHELNRVQGRYALVTMCIGGGQGIAAIFERI 394 +GATG I E++R RY L TMCIGGGQG+AAIFER+ Sbjct: 369 VGATGVRILTTLAREMDRRGARYGLETMCIGGGQGLAAIFERV 411 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 413 Length adjustment: 31 Effective length of query: 363 Effective length of database: 382 Effective search space: 138666 Effective search space used: 138666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory