Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_085218892.1 B9N75_RS11300 SDR family oxidoreductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_900177405.1:WP_085218892.1 Length = 258 Score = 130 bits (327), Expect = 3e-35 Identities = 87/253 (34%), Positives = 131/253 (51%), Gaps = 7/253 (2%) Query: 19 LKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHAL--K 76 L KV ++TG+++GIG AI A A A++ IS +A+ E AA + D A+ Sbjct: 6 LTGKVAIVTGSSRGIGRAIAEALADHGAKVTISSRKADACEEAAAAINGKHGDGTAIVVP 65 Query: 77 ADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLE-MTEEDWRRCFAIDLDGAWY 135 A++S++ +L + +HGR+D+LV A N + P+ +T+E + + ++ + Sbjct: 66 ANISSKDELQTLVDETRRQHGRVDILVCNAASNPYYGPMAGITDEQFGKLLTNNVVANHW 125 Query: 136 GCKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRV 195 V+P+MIE+G GS+I I+S Y + K L L R L EY +GVRV Sbjct: 126 LINMVVPEMIERGEGSVIIISSVAGLSASTTIGAYGITKAADLQLARNLAAEYGARGVRV 185 Query: 196 NAIAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFI 255 N IAPG ++T W D RA P RRIG P E+A AVFLA+ + F+ Sbjct: 186 NCIAPGLVKTDFARALWED-PDTLKAVTRAA---PMRRIGDPHEIAGAAVFLAAPASTFM 241 Query: 256 NASCITIDGGRSV 268 I IDGG ++ Sbjct: 242 TGQAIVIDGGATL 254 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 258 Length adjustment: 25 Effective length of query: 247 Effective length of database: 233 Effective search space: 57551 Effective search space used: 57551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory