Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate WP_157123692.1 B9N75_RS04360 aldehyde dehydrogenase family protein
Query= BRENDA::P23883 (495 letters) >NCBI__GCF_900177405.1:WP_157123692.1 Length = 502 Score = 385 bits (988), Expect = e-111 Identities = 210/481 (43%), Positives = 296/481 (61%), Gaps = 12/481 (2%) Query: 21 RLFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSP 80 +LFI+GE+ ++ + DP T + I D+DRA++AAR F+ G WS P Sbjct: 26 KLFIDGEWVESSHGKRIPVFDPSTGKEIVAIVDASDADVDRAVAAARRAFDDGRWSGLPP 85 Query: 81 AKRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYG 140 +R+ ++ KLADL+EA+ E+A +E++D GKP S D+P A+R+ A K+ G Sbjct: 86 YQRQRLVEKLADLLEANIPEIAEIESIDNGKPRSASQGYDLPKCVAALRYMAGWATKLTG 145 Query: 141 E------VATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSE 194 E + T S H A + REP+GV A IVPWNFPL++ K+ PAL+AG +V+LKP+E Sbjct: 146 EHIEPSGMPTGSIH--AYVRREPIGVAAQIVPWNFPLMMAVQKIAPALSAGCTVVLKPAE 203 Query: 195 KSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLK 254 ++ LSA+R A L EAG+P GVLN+VTG G AG L RH D+D +AFTGST GK ++ Sbjct: 204 QTSLSALRFADLVAEAGIPAGVLNIVTGDGETAGDRLVRHPDVDKVAFTGSTEVGK-IIN 262 Query: 255 DAGDSNMKRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEESI 314 A +KRV LE GGKS IV D D+++ A+ A IF N GQVCIAG+RL + Sbjct: 263 RAATDTLKRVTLELGGKSPVIVLPDV-DIEKTAAGAARSIFANAGQVCIAGSRLFAHRDV 321 Query: 315 ADEFLALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLLDGRN-- 372 D+ L ++ A W+ G L P T MG L+ + V +I +G G +L G + Sbjct: 322 FDKLLEVVADNAGKWKVGPSLAPDTMMGPLVSTEQHERVLGYIDQGRKAGATVLAGGDTP 381 Query: 373 AGLAAAIGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWTR 432 G + PTI VDV+P+ S+ REEIFGPVL RF + + AND+ YGL A+VWTR Sbjct: 382 GGDGWFVNPTILVDVNPDMSVVREEIFGPVLTAQRFDDLDAVAKAANDTNYGLAASVWTR 441 Query: 433 DLSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWIS 492 D+S H+++ ++KAG V+ N + D ++PFGG+KQSG GR+ + +E +TELKT+ I+ Sbjct: 442 DVSAMHKLAAKVKAGMVWGNCPSAADTSLPFGGFKQSGFGRESGRYGIEAYTELKTVAIA 501 Query: 493 L 493 L Sbjct: 502 L 502 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 628 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 502 Length adjustment: 34 Effective length of query: 461 Effective length of database: 468 Effective search space: 215748 Effective search space used: 215748 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory