Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_085219249.1 B9N75_RS13445 acyl-CoA dehydrogenase
Query= BRENDA::Q18AQ1 (378 letters) >NCBI__GCF_900177405.1:WP_085219249.1 Length = 380 Score = 303 bits (775), Expect = 7e-87 Identities = 155/375 (41%), Positives = 235/375 (62%), Gaps = 3/375 (0%) Query: 5 SKKYQMLKELYVSFAENEVKPLATELDEEERFPYETVEKMAKAGMMGIPYPKEYGGEGGD 64 +++ + ++E+ F + + P A E DE+ FP +T+ A+ G I +E GG G Sbjct: 7 TEEQRQIQEMAQQFTADAITPHAAEWDEKHIFPRDTIRSAAELGFGSIYVSEESGGIGLG 66 Query: 65 TVGYIMAVEELSRVCGTTGVILSAHTSLGSWPIYQYGNEEQKQKFLRPLASGEKLGAFGL 124 + + +E ++ C +T +S H ++ SW I ++G + K K+L + + E++G++ L Sbjct: 67 RLEAALIMEAMAYGCPSTSAFISIH-NMASWMIDRFGAQAVKDKYLPSMVTMERIGSYCL 125 Query: 125 TEPNAGTDASGQQTTAVLDGDEYILNGSKIFITNAIAGDIYVVMAMTDKSKGNKGISAFI 184 TEP +G+DA+ +T AV DG+ Y++ GSK FI+ ++YV M T +G KGIS + Sbjct: 126 TEPGSGSDAAALKTKAVKDGNHYVVTGSKAFISGGGENEVYVCMVRTGV-EGPKGISCLV 184 Query: 185 VEKGTPGFSFGVKEKKMGIRGSATSELIFEDCRIPKENLLGKEGQGFKIAMSTLDGGRIG 244 +EK PG SFG EKK+G T+++ F+ R+P ENL+G EG+GF+IAM LDGGR+ Sbjct: 185 IEKDMPGVSFGANEKKLGWHSQPTAQVNFDSVRVPAENLVGGEGEGFRIAMMGLDGGRLN 244 Query: 245 IAAQALGLAQGALDETVKYVKERVQFGRPLSKFQNTQFQLADMEVKVQAARHLVYQAAIN 304 I A +LG AQ LDE + Y KER QFG+P++ FQNTQF LADM+ +QAAR L+Y AA+ Sbjct: 245 IGACSLGGAQRCLDEAIAYTKERKQFGQPIADFQNTQFTLADMDTDLQAARMLLYAAAVK 304 Query: 305 KDLGKPYGVE-AAMAKLFAAETAMEVTTKAVQLHGGYGYTRDYPVERMMRDAKITEIYEG 363 P AAMAK A ++ + +A+QLHGGYGY +DYP+ER RD ++ I EG Sbjct: 305 VTENAPDKTRFAAMAKRLATDSGSSIVDRALQLHGGYGYLQDYPIERFWRDLRVHSILEG 364 Query: 364 TSEVQRMVISGKLLK 378 T++V RM++ +L + Sbjct: 365 TNQVMRMIVGRELTR 379 Lambda K H 0.315 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 380 Length adjustment: 30 Effective length of query: 348 Effective length of database: 350 Effective search space: 121800 Effective search space used: 121800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory