Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate WP_157123969.1 B9N75_RS12890 phosphate ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09895 (257 letters) >NCBI__GCF_900177405.1:WP_157123969.1 Length = 267 Score = 139 bits (349), Expect = 8e-38 Identities = 89/255 (34%), Positives = 135/255 (52%), Gaps = 15/255 (5%) Query: 6 PALEIRNLHKRYGQLEVLKGVSLTARDGDVISILGSSGSGKSTFLRCINLLENPNQGQIL 65 P + N+ YG + + VS+ +V + +G SG GKSTFLR +N + + Sbjct: 18 PRIRAENVSVFYGNKKAIDDVSIDIDQDNVTAFIGPSGCGKSTFLRTLNRMNDT------ 71 Query: 66 VAGEELKLKAAKNGELVAADGKQINRLRSEIGFVFQNFNLWPHMSVLDNIIEAPR-RVLG 124 +A ++ + +GE + + G + +LR+ +G VFQ N +P S+ DN+ PR L Sbjct: 72 IASARVEGRITLDGEDIYSSGMDVVQLRARVGMVFQKPNPFPK-SIFDNVAYGPRIHGLA 130 Query: 125 QSKAEAVEVAEALLAKVGIADKRHAYPAE----LSGGQQQRAAIARTLAMQPKVILFDEP 180 SK+E + E L + G+ D+ A+ LSGGQQQR IAR +A+ P+VIL DEP Sbjct: 131 TSKSELEGIVERSLKRAGLWDEVKDRLADSGTALSGGQQQRLCIARAIAVDPEVILMDEP 190 Query: 181 TSALDPEMVQEVLSVIRALAEEGR-TMLLVTHEMGFARQVSSEVVFLHQGLVEEQGSPQQ 239 SALDP ++ +I L GR +++VTH M A +VS F H G + E G Sbjct: 191 CSALDPIATAKIEELIHEL--RGRYAIVIVTHNMQQAARVSQRTAFFHLGHLVEYGDTSA 248 Query: 240 VFENPLSARCKQFMS 254 +F NP R K +++ Sbjct: 249 IFTNPTETRTKDYIT 263 Lambda K H 0.317 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 267 Length adjustment: 25 Effective length of query: 232 Effective length of database: 242 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory