Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_085219145.1 B9N75_RS12805 ABC transporter ATP-binding protein
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_900177405.1:WP_085219145.1 Length = 311 Score = 96.3 bits (238), Expect = 7e-25 Identities = 69/232 (29%), Positives = 120/232 (51%), Gaps = 27/232 (11%) Query: 3 QPLLSVNGLMMRFG-GLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGT 61 QP+LS+ L + GL A+N+V+L++ EI +L+GPNGAGKTT+ + + G PTGGT Sbjct: 2 QPVLSIASLSKTYASGLTALNDVSLDIRKGEIFALLGPNGAGKTTLISIVCGIVTPTGGT 61 Query: 62 ILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTP 121 +L ++G+ + RM R + Q+L T F + T Sbjct: 62 VL-----VDGVDAARDFRMARTR-----------------IGLVPQELHTDSFETVWATV 99 Query: 122 SFRR---AQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLD 178 +F R + + L+ + L + + L+ G +RR+ IA+ + +P+IL LD Sbjct: 100 TFSRGLFGKPPSPAHVEKVLKDLSLWDKRKSKIQELSGGMKRRVMIAKALSHEPDILFLD 159 Query: 179 EPAAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQG 230 EP AG++ + +++ L+ LR TI+L H ++ ++DR+ V+++G Sbjct: 160 EPTAGVDVELRRDMWALVHRLR-EGGVTIILTTHYIEEAEEMADRVGVISKG 210 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 311 Length adjustment: 26 Effective length of query: 229 Effective length of database: 285 Effective search space: 65265 Effective search space used: 65265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory