Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_085219145.1 B9N75_RS12805 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_900177405.1:WP_085219145.1 Length = 311 Score = 111 bits (278), Expect = 2e-29 Identities = 77/230 (33%), Positives = 128/230 (55%), Gaps = 21/230 (9%) Query: 3 LLEVKQLTKHFG-GLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVT 61 +L + L+K + GLTA+ DV+L++ +GE+ L+GPNGAGKTTL +++ G+ P+ GTV Sbjct: 4 VLSIASLSKTYASGLTALNDVSLDIRKGEIFALLGPNGAGKTTLISIVCGIVTPTGGTVL 63 Query: 62 LDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAF 121 +DG ++ +++A +G Q + TV V + G F + P+ Sbjct: 64 VDG--VDAARDFRMARTRIGLVPQELHTDSFETVWATVTFSRG---------LFGKPPSP 112 Query: 122 YKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAG 181 EK LK L ++D ++ + LS G +RR+ I +AL+ EP ILFLDEP AG Sbjct: 113 AHVEKVLKD-----LSLWD---KRKSKIQELSGGMKRRVMIAKALSHEPDILFLDEPTAG 164 Query: 182 MNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLI 231 ++ + ++ L+ R++ E +TI+L H + E+ +R+ V+ G LI Sbjct: 165 VDVELRRDMWALVHRLR-EGGVTIILTTHYIEEAEEMADRVGVISKGELI 213 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 311 Length adjustment: 26 Effective length of query: 228 Effective length of database: 285 Effective search space: 64980 Effective search space used: 64980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory