GapMind for catabolism of small carbon sources

 

Protein WP_085544777.1 in Dethiosulfovibrio salsuginis USBA 82

Annotation: NCBI__GCF_900177735.1:WP_085544777.1

Length: 351 amino acids

Source: GCF_900177735.1 in NCBI

Candidate for 60 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 95% 269.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 43% 94% 268.5 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 93% 265.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism malK med ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 42% 96% 261.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 93% 260.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
putrescine catabolism potA med Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 42% 89% 260 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 45% 85% 259.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 45% 85% 259.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
lactose catabolism lacK med LacK, component of Lactose porter (characterized) 46% 79% 249.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 46% 72% 247.7 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 41% 97% 247.3 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 41% 95% 246.9 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 91% 246.9 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 44% 85% 242.7 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 87% 235.3 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 87% 235.3 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 87% 235.3 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 42% 80% 229.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 42% 76% 217.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 38% 97% 248.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 37% 98% 246.9 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 37% 98% 246.9 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 52% 58% 246.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 46% 68% 242.7 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 38% 95% 238 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 234.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 234.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 234.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 234.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 234.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 234.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 79% 230.7 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 100% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 96% 227.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 77% 214.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 77% 214.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 77% 214.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 77% 214.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 36% 91% 207.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 38% 77% 190.3 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 37% 92% 151.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 34% 87% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 34% 87% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3
L-phenylalanine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale) 34% 92% 118.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 44% 284.3

Sequence Analysis Tools

View WP_085544777.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MELRISEVSKVFPSHDGGAVVRAVDSVNLTVADGELVTLLGPSGCGKTTLLRMIAGFEDP
SEGDLYFGDRRVNNVAPNRRNATLVFQSYAIFPHLNVFENIAFGLRLKGLKEGDIRSKME
KVVHMVGLGGMETRRPSQLSGGQQQRVALARAVVMEPELLLFDEPLSNLDAKLREQMRID
IRRLQKALGITSVYVTHDQAEAMSISDRVVVMKDGRIEQSGSPVDLYARPRNRFVADFIG
KANFLDGTASEGGVILGGKSYPMDIAPSEVGEAQVVARPEALVLSRDEGHFPCEVMRTTF
LGNLVEYEVECPNLGTLTVHQVNPMAGELFRPGESIQVSLRPETLHILEKE

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory