Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_085543521.1 B9Y55_RS01195 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >NCBI__GCF_900177735.1:WP_085543521.1 Length = 248 Score = 119 bits (299), Expect = 5e-32 Identities = 81/249 (32%), Positives = 124/249 (49%), Gaps = 7/249 (2%) Query: 22 KVVLLTGAAQGIGEAIVAAFASQQARLVIS-DIQAQKVEAVAAHWRERGADVHALQADVS 80 +VVL+TG A+GIG+AI AS ++ ++ AQ + G A+ DVS Sbjct: 6 RVVLVTGGAKGIGKAISLKLASAGYQVAVNYRSSAQSASELVEEINASGGVAMAVSGDVS 65 Query: 81 KQQDLQAMARRAVELHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGCKAV 140 D++ + + G ++VLVN AGV + M EEDW +L A+ K Sbjct: 66 SSDDVKGIFSSVAKELGPVEVLVNNAGVTRDGLLMRMKEEDWDTVIDGNLKSAFLCSKEA 125 Query: 141 LPQMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAP 200 + M + G I+N+ASV PG Y +K GL+GLT+++ EYA +G+ VNA+AP Sbjct: 126 IKAMSKGRWGRIVNMASVVGLIGNPGQANYCSSKAGLIGLTKSVAREYAQRGITVNAVAP 185 Query: 201 GYIETQLNVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVFLASDEAPFINASCI 260 G+I T + P + + + P R G +VA FL SDEA +I + Sbjct: 186 GFIVTDMTE------VLPQSVKDGMVSSIPSGRPGTVEDVASAVAFLVSDEASYITGQVL 239 Query: 261 TIDGGRSVM 269 +DGG +++ Sbjct: 240 AVDGGMTMV 248 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 248 Length adjustment: 24 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory