Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_085543671.1 B9Y55_RS01935 sugar ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_900177735.1:WP_085543671.1 Length = 252 Score = 183 bits (464), Expect = 3e-51 Identities = 98/239 (41%), Positives = 157/239 (65%), Gaps = 6/239 (2%) Query: 1 MSDLLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGD 60 M ++E++ + KSFG+V+AL V +N GEVVALLGDNGAGKSTLIKI+SG+H DRG Sbjct: 1 MEAMVEMKGIGKSFGSVEALRQVDFRLNPGEVVALLGDNGAGKSTLIKILSGFHSADRGS 60 Query: 61 LVFEGKKVIFNS--PNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNK--IFLNKKK 116 ++ +G+++ F + ARSLG+ET+YQ+ +L P++ N+F+ R N+ + K++ Sbjct: 61 MMVKGREIDFKAYDVTVARSLGVETVYQERSLGERQPLWRNVFIGRHRLNRWGLIDVKRE 120 Query: 117 MMEESKKLLDSLQIRIPDI--NMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSV 174 ME + L L +R + + VE LSGG+RQ +A+ RA++F A +I++DEPT AL++ Sbjct: 121 KMETMELLSSVLGLRGAGLSPDASVETLSGGERQGLAIGRAMHFGADIIVLDEPTTALAL 180 Query: 175 VEARKVLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEI 233 E KVL ++++ G ++I+H++ Y+VADR ++DRG + +K + EE+ Sbjct: 181 SEVGKVLSFIGSIREDGRSCIVISHDLGHVYKVADRFVLMDRGSTVGDYRKGDITPEEL 239 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 252 Length adjustment: 24 Effective length of query: 227 Effective length of database: 228 Effective search space: 51756 Effective search space used: 51756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory