Align glucose transporter, ATPase component (characterized)
to candidate WP_085543671.1 B9Y55_RS01935 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_900177735.1:WP_085543671.1 Length = 252 Score = 157 bits (398), Expect = 2e-43 Identities = 92/246 (37%), Positives = 139/246 (56%), Gaps = 15/246 (6%) Query: 15 LVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRV 74 +VEMK I SFG ++A+ V L PGEVV LLG NGAGKSTLIK+LSG + D G + V Sbjct: 4 MVEMKGIGKSFGSVEALRQVDFRLNPGEVVALLGDNGAGKSTLIKILSGFHSADRGSMMV 63 Query: 75 NGDKVEIT--NPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGLVDDSAMEAE 132 G +++ + ARS +ET+YQ +L + N+F+GR + +GL+D + E Sbjct: 64 KGREIDFKAYDVTVARSLGVETVYQERSLGERQPLWRNVFIGRHRLNRWGLIDVKREKME 123 Query: 133 CRKIMNR--------LNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAAL 184 ++++ L+P+ V LSGG+RQ +AI RA++F A I+++DEPT AL Sbjct: 124 TMELLSSVLGLRGAGLSPDAS-----VETLSGGERQGLAIGRAMHFGADIIVLDEPTTAL 178 Query: 185 GPHETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLVGTVDIDDVTDDD 244 E V I ++ G +I HD+ V ++ DR +M G VG D+T ++ Sbjct: 179 ALSEVGKVLSFIGSIREDGRSCIVISHDLGHVYKVADRFVLMDRGSTVGDYRKGDITPEE 238 Query: 245 LLSMII 250 L++ +I Sbjct: 239 LMARMI 244 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 252 Length adjustment: 24 Effective length of query: 236 Effective length of database: 228 Effective search space: 53808 Effective search space used: 53808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory