GapMind for catabolism of small carbon sources

 

Protein WP_089217943.1 in Sphingomonas laterariae LNB2

Annotation: NCBI__GCF_900188165.1:WP_089217943.1

Length: 351 amino acids

Source: GCF_900188165.1 in NCBI

Candidate for 103 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 40% 88% 235.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 40% 99% 227.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 45% 79% 222.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-cellobiose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-glucose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
lactose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
sucrose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
putrescine catabolism potA med Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 45% 76% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 43% 77% 214.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 40% 88% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 43% 79% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-mannitol catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 40% 82% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-sorbitol (glucitol) catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 40% 82% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 45% 71% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 40% 91% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 45% 71% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 43% 73% 205.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 43% 73% 205.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 73% 195.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 41% 73% 173.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 41% 98% 169.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 40% 98% 160.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 41% 80% 146.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 92% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 93% 216.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 46% 69% 215.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 96% 211.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 96% 211.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 96% 211.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 34% 97% 209.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 35% 98% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 99% 203.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 37% 81% 202.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 85% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 37% 82% 198 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 85% 196.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 94% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 94% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 94% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 94% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 94% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 94% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 36% 88% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 33% 97% 181 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 34% 86% 166.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 40% 88% 162.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 87% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 87% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 36% 67% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 39% 90% 158.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 98% 157.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 38% 96% 157.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 98% 157.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 91% 156 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 91% 156 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 91% 155.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 91% 155.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 40% 68% 154.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 38% 90% 152.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 92% 148.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 37% 97% 146 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 35% 94% 145.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-histidine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 35% 97% 142.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 33% 98% 140.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 33% 98% 140.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 33% 93% 140.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-leucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 33% 93% 140.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-valine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 33% 93% 140.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 33% 92% 137.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-phenylalanine catabolism livG lo ABC transporter ATP-binding protein (characterized, see rationale) 34% 86% 129.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-serine catabolism Ac3H11_1693 lo ABC transporter ATP-binding protein (characterized, see rationale) 34% 86% 129.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-tyrosine catabolism Ac3H11_1693 lo ABC transporter ATP-binding protein (characterized, see rationale) 34% 86% 129.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 38% 77% 128.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 31% 78% 122.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 32% 87% 116.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 30% 97% 111.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 91% 107.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 91% 107.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 91% 107.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 91% 107.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 30% 86% 103.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0
L-proline catabolism HSERO_RS00900 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 30% 94% 96.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 342.0

Sequence Analysis Tools

View WP_089217943.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSIKLDTISKNFGGFTALGNINLEIEPGEFLALLGPSGSGKTTLLRIIAGLEFPDTGRVY
YDGDDITDLKVADRGVGFVFQHYALFRHMTVADNVAFGLTVRKRRDRPAKSVIQARVQEL
LDLVQLGHLGKRYPAQLSGGQRQRVALARALAVEPRLLLLDEPFGALDARVRKDLRRWLR
ELHDSVGLTSIFVTHDQDEALELADRVVVMDHGVIEQIDTPQKIYDEPASAFVFDFVGES
NQVAVTIAGGEARLFDRTLPLPAGTTLPGDGPARLFFRPHDAEIVADDKAGLAATVTLTR
PNSGSIRVEGKLDGLDRLVEIDVPVEGAPQVGERIIVRPTRVKLYAGRAEA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory