Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_089217943.1 CHB74_RS02270 sulfate/molybdate ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900188165.1:WP_089217943.1 Length = 351 Score = 196 bits (498), Expect = 8e-55 Identities = 128/366 (34%), Positives = 195/366 (53%), Gaps = 42/366 (11%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 I + +SK F G AL N+N+ IE GE +LGPSG+GKTT +RIIAGL+ P TG +Y Sbjct: 3 IKLDTISKNF--GGFTALGNINLEIEPGEFLALLGPSGSGKTTLLRIIAGLEFPDTGRVY 60 Query: 64 FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKM----SKEEIRK 119 +D + + DR +G VFQ +AL+ ++T +N+AF LT K +K I+ Sbjct: 61 YDGDDITD-----LKVADRGVGFVFQHYALFRHMTVADNVAFGLTVRKRRDRPAKSVIQA 115 Query: 120 RVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSA 179 RV+E+ ++ + H+ +P +LSGGQ+QRVALARAL +P LLLLDEPF LDAR+R Sbjct: 116 RVQELLDLVQLGHLGKRYPAQLSGGQRQRVALARALAVEPRLLLLDEPFGALDARVRKDL 175 Query: 180 RALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVAS 239 R ++E+ +G+T + V+HD + +ADRV V+ G + Q+ P+ +YD P S V Sbjct: 176 RRWLRELHDSVGLTSIFVTHDQDEALELADRVVVMDHGVIEQIDTPQKIYDEPASAFVFD 235 Query: 240 LIGEINELEGKVTNEGVVIGSLRFPVSVSS-----DRAIIGIRPEDVKLSKDVIKDDSWI 294 +GE N++ + + P+ + A + RP D +++ DD Sbjct: 236 FVGESNQVAVTIAGGEARLFDRTLPLPAGTTLPGDGPARLFFRPHDA----EIVADDKAG 291 Query: 295 LV--------GKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEV--LVYVRK 344 L G ++V G GL R+ EI D P+ +V + VR Sbjct: 292 LAATVTLTRPNSGSIRVEGKLDGLDRLV--------EI----DVPVEGAPQVGERIIVRP 339 Query: 345 DKIKVF 350 ++K++ Sbjct: 340 TRVKLY 345 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 351 Length adjustment: 29 Effective length of query: 324 Effective length of database: 322 Effective search space: 104328 Effective search space used: 104328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory