Align D-mannitol and D-mannose transporter (MFS superfamily) (characterized)
to candidate WP_089217922.1 CHB74_RS02120 sugar MFS transporter
Query= reanno::SB2B:6936374 (413 letters) >NCBI__GCF_900188165.1:WP_089217922.1 Length = 435 Score = 316 bits (810), Expect = 7e-91 Identities = 170/394 (43%), Positives = 251/394 (63%), Gaps = 20/394 (5%) Query: 28 MTSLFFIWGFITALNDILIPHLKGIFDLSYTQAMLVQFCFFGAYFLVSPLAGVLIARIGY 87 + SLFF+WGFIT +N+ L+PHL+ +FDL+YTQ ++ +F AYF+ S + LI RIGY Sbjct: 29 LASLFFMWGFITVINNTLLPHLRSVFDLTYTQTTAIESVWFIAYFVASIPSAKLIERIGY 88 Query: 88 LRGIIFGLSTMATGCLLFYPASSLEQYALFLLALFVLASGITILQVSANPFVARLGPERT 147 + ++ GL MA G L A+SL Y + L LF++A GIT+LQV+ANP+VA +G T Sbjct: 89 QKSLVVGLLIMAAGSLGMMLAASLPSYGVTLAMLFLIACGITLLQVAANPYVAVVGKPET 148 Query: 148 AASRLNLAQALNSLGHTLGPLFGSLLIFGAAAG----------------THEAVQLPYLL 191 A+SRLNL QA+NS G L PLFG+ LI G + G ++V LPY L Sbjct: 149 ASSRLNLVQAMNSAGTMLAPLFGAYLILGRSKGGTAETGVVLTQAERLADAQSVILPYGL 208 Query: 192 LAAVIGIIAV---GFIFLGGKVKHADMGVDHRHKGSLLSHKRLLLGALAIFLYVGAEVSI 248 +A V+ ++A+ F M + R K SL +H+ L+ G AIF+Y+ AE+ + Sbjct: 209 VAVVLLVLAIVIARFPLPAMGSAALRMPKEERKKHSLWAHRNLVFGVPAIFIYLIAEIGV 268 Query: 249 GSFLVNYFAEPSIGGLDEKSAAELVSWYWGGAMIGRFAGAALTRRFNPAMVLAANAVFAN 308 + VN+ ++P I L + A +++ WGG M+GRFAG+A+ +RF+ A VLA ++ A Sbjct: 269 ANLFVNFVSQPDIANLTHEQAGRYLTFLWGGMMVGRFAGSAIMQRFDAAKVLAVFSIGAF 328 Query: 309 LLLMLTIVSSGELALVAVLAVGFFNSIMFPTIFTLAIEGLGELTSRGSGLLCQAIVGGAL 368 +++M+T+ + G +A+ +++ VG F+SIMFPTIFTL I+GLG LT GSGLL AI GGAL Sbjct: 329 IVMMVTVFAHGPVAMWSLILVGLFHSIMFPTIFTLGIKGLGPLTEEGSGLLIMAIAGGAL 388 Query: 369 LPVIQGVVADNVGVQLSFIVPTFCYFYICWYAFF 402 + + QG +AD G+Q+SF++ C Y+ +YA + Sbjct: 389 V-IAQGWLADQYGLQMSFLLTAACELYVLFYALW 421 Lambda K H 0.329 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 435 Length adjustment: 32 Effective length of query: 381 Effective length of database: 403 Effective search space: 153543 Effective search space used: 153543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory