Align acetyl-CoA C-acyltransferase (EC 2.3.1.16) (characterized)
to candidate WP_089216969.1 CHB69_RS16130 acetyl-CoA C-acyltransferase
Query= BRENDA::Q8VCH0 (424 letters) >NCBI__GCF_900188185.1:WP_089216969.1 Length = 393 Score = 278 bits (710), Expect = 3e-79 Identities = 169/394 (42%), Positives = 242/394 (61%), Gaps = 15/394 (3%) Query: 37 DVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA 96 D V+V RTP+ +A+RG F +T L + + A ++ L+ ++ D+ G +Q G+ Sbjct: 3 DAVIVSTARTPLTKAARGSFNNTPSPTLGAFSVKAAVERAGLEGGEIDDVVFGAAMQQGS 62 Query: 97 GAI-MARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTL 155 + +AR+ +G+P TVP +++RQCSSGL +A A I DI +A GVES + Sbjct: 63 QSPNVARLIALRAGLPVTVPGMSIDRQCSSGLMTIATAAKQIIVDRQDICVAGGVES--I 120 Query: 156 SQRGNHGNI----SSRLLENEKARDCLIPMGITSENVAERFGVSRQKQDAFALASQQKAA 211 S+ G + + LL K D +PM T+E VA+R+ + R+ QD ++L SQQ+ A Sbjct: 121 SKVSGSGKVFIEPDAELLAMHK--DTYMPMIGTAEVVAKRYNIGREAQDEYSLQSQQRTA 178 Query: 212 SAQSRGCFHAEIVPVTTTV-LNDKGDK----KTITVSQDEGVRPSTTMQGLAKLKPAFKD 266 +AQ+ G F EI+P T+ + DK K K +T +DE RP TT++GLA LKP + Sbjct: 179 AAQAAGKFADEIIPCKATMAIVDKETKEVSYKDVTADRDECNRPDTTLEGLASLKPVMGE 238 Query: 267 GGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIP 326 G + TAGN+SQ+SDG++A ++ AE+ GL LG AV G PD MGIGP +AIP Sbjct: 239 GHTITAGNASQLSDGSSACVVMEAKVAEKRGLQPLGRYVGMAVAGTEPDEMGIGPVFAIP 298 Query: 327 AALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQ 386 L++ L ++DI ++E+NEAFA Q +YC +KLGIP E +N GG+I++GHP G TGAR Sbjct: 299 KLLERFELKMDDIGLWELNEAFAVQVLYCRDKLGIPNELLNVNGGSISIGHPFGMTGARC 358 Query: 387 VVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFE 420 V L E KRRG + Y VV+MCIG G GAA +FE Sbjct: 359 VGHALIEGKRRGVK-YAVVTMCIGGGQGAAGLFE 391 Lambda K H 0.317 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 393 Length adjustment: 31 Effective length of query: 393 Effective length of database: 362 Effective search space: 142266 Effective search space used: 142266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory