Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_089216568.1 CHB69_RS13650 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_900188185.1:WP_089216568.1 Length = 267 Score = 111 bits (278), Expect = 1e-29 Identities = 84/252 (33%), Positives = 123/252 (48%), Gaps = 9/252 (3%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRA---RTAHPQLHAGVADVSD 68 G +I+GA +GIG A A F GA + I D A D A + A ++ A D Sbjct: 6 GKIAIITGAGSGIGRASALRFAAEGARLVIGDKTAAVHDTAAAVKDAGGEVVALEIDAGV 65 Query: 69 CAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKA 128 A V +++ A+ GGLD+ NAGI G G + D+ P W T+ NL ++ A Sbjct: 66 EADVAKLVAAAQGTYGGLDIAFANAGIIGDMGGIFDITPEGWAETLRVNLIGPALMVKHA 125 Query: 129 VPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAIL 188 + + I+ ASVAG A Y+ASK ++ + K+ A ++ NVRVNAI Sbjct: 126 GRAMVDQGRGGAIVLTASVAGLNSGAGPAAYSASKAGVINLAKTAAQQMTTANVRVNAIC 185 Query: 189 PGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQN 248 PG+ E M R A+ G+ + Q L+R ++A +ALFLAS Sbjct: 186 PGLTE-TGMTRPTFDYAKEKGV-----THKIGQLNPLKRAGQPEELANVALFLASDQASY 239 Query: 249 ISGQAISVDGNV 260 ++GQAI+VDG + Sbjct: 240 VNGQAIAVDGGL 251 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 267 Length adjustment: 25 Effective length of query: 238 Effective length of database: 242 Effective search space: 57596 Effective search space used: 57596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory