Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_089214652.1 CHB69_RS04180 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_900188185.1:WP_089214652.1 Length = 398 Score = 343 bits (881), Expect = 6e-99 Identities = 183/392 (46%), Positives = 246/392 (62%), Gaps = 3/392 (0%) Query: 5 TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63 T+ D+ D+ GKRV++RVD NVP+ DG V D TR++AA+PTI+ ++GA V+LL+H GRP Sbjct: 6 TLDDIGDVTGKRVLVRVDLNVPMADGAVSDATRLQAAVPTIRELSDKGAIVLLLAHFGRP 65 Query: 64 KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123 KG +P SL+ V L ++LG V F+P +GD K V L G+V +LENTRF+PGE Sbjct: 66 KGAKNPAQSLSLVMGGLEDVLGHSVMFIPDCIGDGAKAGVAVLAPGDVAVLENTRFYPGE 125 Query: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 183 KNDP A A + D++VNDAF AHRAH S GIA +P+ AG ME E+K L Sbjct: 126 EKNDPAFADALAEIGDLYVNDAFSAAHRAHGSTEGIAHRLPAFAGRAMEAELKALDAALG 185 Query: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 243 NP P V+GGAKVS KI V+ NL+ + D ++IGG M TFL A G +VG S E D + Sbjct: 186 NPAHPVAAVVGGAKVSTKIDVLKNLVGRVDHLIIGGGMANTFLAARGVDVGKSLCEHDLV 245 Query: 244 DLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 303 D A + E A G I LP D V+A++ P + V + + P+ M LD+GP +E Sbjct: 246 DTANAIFEAADSAGCTIHLPYDVVVAREFAPNPPTRTVNVHEVAPDE-MILDVGPAAVEA 304 Query: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGA-ITVVGGGDSAAAVNK 362 L +T+VWNGP+G FE F T +A AALT +G+ I+V GGGD+ AA+N Sbjct: 305 LADVLKTCRTLVWNGPLGAFETPPFDAATVALAKTAAALTREGSLISVAGGGDTVAALNH 364 Query: 363 FGLEDKFSHVSTGGGASLEFLEGKELPGIASI 394 G+ F+ VST GGA LE++EGK LPG+ ++ Sbjct: 365 AGVAGDFTFVSTAGGAFLEWMEGKPLPGVDAL 396 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 619 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 398 Length adjustment: 34 Effective length of query: 620 Effective length of database: 364 Effective search space: 225680 Effective search space used: 225680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory