Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate WP_089214379.1 CHB69_RS02585 acetyl-CoA C-acyltransferase
Query= uniprot:D8ITH5 (401 letters) >NCBI__GCF_900188185.1:WP_089214379.1 Length = 395 Score = 249 bits (635), Expect = 1e-70 Identities = 153/394 (38%), Positives = 222/394 (56%), Gaps = 15/394 (3%) Query: 10 RTPFGRYGGALGAVRADDLAAAPIRSLMERNPGVDWSRVEDILYGCANQAGEDNRNVARM 69 RTP G G L A DL A +++ +ER GV VE I GC AG + AR Sbjct: 14 RTPMGGMQGVLSDASATDLGATAVKAAVER-AGVKGEDVERIYMGCVLPAGL-GQAPARQ 71 Query: 70 AGLLAGLPIAVPGSTVNRLCGSSLDAVGMAARAIKSGEVQLMIAGGVESMTRAPFVMGKA 129 A + AGLP +V +TVN++CGS + V M A A+ +G + L +AGG+ESMT AP+++ K Sbjct: 72 AAIKAGLPKSVQATTVNKVCGSGMQTVIMGAEALAAGSIDLAVAGGMESMTNAPYLLKKH 131 Query: 130 ESAFARSAAIFDTTIGWRFVNPLMKAQYGIDSMPETAENVATDFQINRADQDAFALRSQQ 189 S AR DT F++ L A +M A++ A +Q++R QD +A+ S + Sbjct: 132 RSG-ARIG--HDTAYDHMFLDGLEDAYDAGRAMGTFAQDTADAYQLSRQAQDDYAIESLR 188 Query: 190 RWAAAQAAGFFAGEIAPLTIPQKKGDPLVVTTDEHP---RPDTTLATLAKLKGVVRPDGT 246 R AA A G FA EI P+T+ +KG+ +VV TDE P PD + L+ DGT Sbjct: 189 RAQAAIADGAFAAEITPVTLTTRKGE-VVVDTDEQPGKGNPDK----IPTLRPAFAKDGT 243 Query: 247 VTAGNASGVNDGACALLLASPKAADLYRLKPRARVLGMATAGVAPRIMGFGPAPAVRKVL 306 +TA +S ++DGA A++L A+ KP A+++ A P+ P A+ KVL Sbjct: 244 ITAATSSSISDGAAAVVLTRQSVAEKKGAKPVAKLVAHAAHAQEPKDFTVAPIGAINKVL 303 Query: 307 AQVGLTLAQMDVIELNEAFAAQGLAVMRDLGLPDDAAHVNPNGGAIAIGHPLGASGARLV 366 A+ G ++ +D+ E+NEAFA + M DLG+P D +N NGGA A+GHP+GASG R++ Sbjct: 304 AKAGWSIGDVDLFEVNEAFACVAMFAMHDLGIPHD--RINVNGGATALGHPIGASGTRII 361 Query: 367 TTAINQLERSGGRYALCTMCIGVGQGIALVIERV 400 T I L+ G + + ++CIG G+ A+ IE V Sbjct: 362 ATLIAALQNRGKKRGIASLCIGGGEATAVAIELV 395 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 395 Length adjustment: 31 Effective length of query: 370 Effective length of database: 364 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory