Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_089216969.1 CHB69_RS16130 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_900188185.1:WP_089216969.1 Length = 393 Score = 475 bits (1223), Expect = e-139 Identities = 247/393 (62%), Positives = 292/393 (74%), Gaps = 1/393 (0%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQ 60 M +AVIVSTARTP+ KA RG+ N T TL +++ AV+RAG++ E++DVV GAAMQQ Sbjct: 1 MRDAVIVSTARTPLTKAARGSFNNTPSPTLGAFSVKAAVERAGLEGGEIDDVVFGAAMQQ 60 Query: 61 GATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESI 120 G+ N+AR LRAGLPVT G +IDRQC+SGL IA AA+ ++ D +I V GG ESI Sbjct: 61 GSQSPNVARLIALRAGLPVTVPGMSIDRQCSSGLMTIATAAKQIIVDRQDICVAGGVESI 120 Query: 121 SLVQNDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGISRERQDEYSLESQRRTAA 180 S V F D L A+ D YM M+ TAE VAKRY I RE QDEYSL+SQ+RTAA Sbjct: 121 SKVSGSG-KVFIEPDAELLAMHKDTYMPMIGTAEVVAKRYNIGREAQDEYSLQSQQRTAA 179 Query: 181 AQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKAVRGEG 240 AQ GKF DEI P M +VDK T VS+KD+T +DE RP+TT EGLA LK V GEG Sbjct: 180 AQAAGKFADEIIPCKATMAIVDKETKEVSYKDVTADRDECNRPDTTLEGLASLKPVMGEG 239 Query: 241 FTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPVFAVPR 300 TITAGNASQLSDG+SA V+M K A +GL+PLG + GM G EPDEMGIGPVFA+P+ Sbjct: 240 HTITAGNASQLSDGSSACVVMEAKVAEKRGLQPLGRYVGMAVAGTEPDEMGIGPVFAIPK 299 Query: 301 LLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMSGARLA 360 LL+R L +DDIGLWELNEAFAVQVLYCRDKLGI E LNVNGG+IS+GHP+GM+GAR Sbjct: 300 LLERFELKMDDIGLWELNEAFAVQVLYCRDKLGIPNELLNVNGGSISIGHPFGMTGARCV 359 Query: 361 GHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEI 393 GHALIEG+RR KYAVVTMC+GGG G+AGLFE+ Sbjct: 360 GHALIEGKRRGVKYAVVTMCIGGGQGAAGLFEV 392 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 393 Length adjustment: 31 Effective length of query: 364 Effective length of database: 362 Effective search space: 131768 Effective search space used: 131768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory