Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_097029724.1 CRO07_RS05760 CoA transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_900207575.1:WP_097029724.1 Length = 209 Score = 201 bits (510), Expect = 1e-56 Identities = 108/190 (56%), Positives = 134/190 (70%), Gaps = 3/190 (1%) Query: 9 RTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGDK-EVFLHSENGLLGMGPSPAPGEEDD 67 R +MA R A ++Q+G YVNLGIG PTLVANY+ D EV L SENG+LGMGP P GEED Sbjct: 5 RNQMAARAAQELQDGWYVNLGIGIPTLVANYIPDGIEVTLQSENGMLGMGPFPWEGEEDP 64 Query: 68 DLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEGSI 127 DLINAGKQ +T L A+F A SF+M+RGG + +A+LGA +VS +GDLANW + + Sbjct: 65 DLINAGKQTITELPRTAYFDSAQSFAMIRGGKIAMAILGAMEVSEQGDLANWMIPGK-LV 123 Query: 128 PAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVTPE 187 +GGAMDL G +V V+MDH K GESK++ CT PLTG V RI T+L VL+V Sbjct: 124 KGMGGAMDLVAGVGRVVVVMDHTNKAGESKVLHACTLPLTGKGVVDRIITNLGVLDVVEG 183 Query: 188 GLKVVEICAD 197 GL++VE CAD Sbjct: 184 GLRIVE-CAD 192 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 209 Length adjustment: 21 Effective length of query: 192 Effective length of database: 188 Effective search space: 36096 Effective search space used: 36096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory