Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_097029026.1 CRO07_RS00595 ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_900207575.1:WP_097029026.1 Length = 272 Score = 129 bits (325), Expect = 5e-35 Identities = 85/246 (34%), Positives = 133/246 (54%), Gaps = 10/246 (4%) Query: 6 ILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRL 65 ++ + + R+G V A+ FD+ GEI A+IG NGAGKSSM+ ISG P EGE+ Sbjct: 20 LMEMKNITLRFGGVKAITDISFDIREGEIRAIIGPNGAGKSSMLNVISGFYVPQEGEVWF 79 Query: 66 EGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGR-EIRKPGIMGK---WFRSL 121 G+ P E Q GI +QN+AL +S+ DN+ GR + K G+ + W R+ Sbjct: 80 RGRRRPQMKPYEVAQQGIARTFQNIALFEGMSVLDNIMTGRLTLMKTGLWQQALWWGRA- 138 Query: 122 DRAAMEKQARAKLSE-LGLMTIQNINQA-VETLSGGQRQGVAVARAAAFGSKVVIMDEPT 179 A E + RAK+ + + + IQ+I + V L G ++ V +ARA A K++++DEP Sbjct: 139 --QAEEVEHRAKVEKIIDFLEIQHIRKTPVGRLPYGLKKRVELARALATEPKLLLLDEPM 196 Query: 180 AALGVKESRRVLELILDVRRR-GLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDY 238 A + V+E + ILD G I LI H+M V +++DR+ + G+++ P + Sbjct: 197 AGMNVEEKEDMSRFILDTNDEFGTTICLIEHDMGVVMDLSDRVVVMDYGKKIGDGTPDEV 256 Query: 239 TMSDAV 244 + AV Sbjct: 257 RSNQAV 262 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 272 Length adjustment: 25 Effective length of query: 235 Effective length of database: 247 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory