Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_097030694.1 CRO07_RS10735 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_900207575.1:WP_097030694.1 Length = 646 Score = 333 bits (853), Expect = 1e-95 Identities = 191/487 (39%), Positives = 280/487 (57%), Gaps = 13/487 (2%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F ++L+ANRGEIA RV+ + +G++ +AV+S+AD A+H AD++ +IG A DSYL Sbjct: 2 FRKILIANRGEIACRVIATARRLGISTVAVFSDADAAALHVALADDSRHIGGAQPADSYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 + II AA +AIHPGYGFLSEN +F + V AG+TFIGPS++ +R + K K Sbjct: 62 RADRIIQAALATGAEAIHPGYGFLSENPDFVDQVTAAGLTFIGPSADAIRAMGLKDAAKA 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 L AGVP PG G D +A +IGYP+++KA +GGGG G+ RVD D Sbjct: 122 LMEKAGVPVVPGYHGEDQEPDHLAVMAAEIGYPVLIKAVAGGGGKGMRRVDRAADFADAL 181 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 + A AFG + IEKY PRHIE Q+ GD + V ER+C++QRR+QK+IEE Sbjct: 182 ASARAEARTAFGNDAVLIEKYIDQPRHIEIQIFGDG-TDAVHLHERDCSLQRRHQKVIEE 240 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAF--SDVSRD--FYFLELNKRLQVE 299 AP+P + E R +M E ++ + I Y GT E SD R F+F+E+N RLQVE Sbjct: 241 APAPGMTPEMRAAMGEAAVRAARAIGYRGAGTCEFIVDGSDGLRPDRFWFMEMNTRLQVE 300 Query: 300 HPTTELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGF 359 HP TE + IDLV+ Q+++A+GE LP +Q + + G A E R+ AED F ++G Sbjct: 301 HPVTEAVTGIDLVEWQLRIASGEPLPLTQAQI--PLIGHAFEARLYAEDVPAGFLPATGR 358 Query: 360 VTYYREPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGG 419 + + R G+R D+G+ SG + P+YD +++K++ +G SR A+ RAL D ++ G Sbjct: 359 LDHLR--FADGIRADTGVRSGDRISPWYDPMIAKIVAHGPSRAAALNRLARALEDTEVAG 416 Query: 420 IKTTIELYKWIMQDPDFQEGKFSTSYISQKTDQFVKYLREQEEIKAAIAAEIQSRGLLRT 479 T + + + P F G+ T I++ + L + + AI A L T Sbjct: 417 TVTNLAFLSRLARHPGFAAGRVDTGLIARD----IASLTDPAPVTPAITAAALLTAELGT 472 Query: 480 SSTDNKG 486 ++ +G Sbjct: 473 AAAPLQG 479 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 749 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 646 Length adjustment: 36 Effective length of query: 473 Effective length of database: 610 Effective search space: 288530 Effective search space used: 288530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory