Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_097031093.1 CRO07_RS12855 acyl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_900207575.1:WP_097031093.1 Length = 403 Score = 536 bits (1382), Expect = e-157 Identities = 271/389 (69%), Positives = 311/389 (79%), Gaps = 2/389 (0%) Query: 7 FNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLG 66 F+W DP LD QL+EEERM+RDSA +AQ+KLAPRV A+R EQTDP IFREMG +GLLG Sbjct: 15 FDWEDPFRLDLQLSEEERMMRDSARAYAQEKLAPRVTAAYRDEQTDPTIFREMGAMGLLG 74 Query: 67 ATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLP 126 ATIPE+YGG G +YV YGLIARE+ER+DSGYRSMMSVQSSLVM P+ +G+E Q++KYLP Sbjct: 75 ATIPEEYGGLGASYVAYGLIAREIERVDSGYRSMMSVQSSLVMYPVYAYGSEEQRRKYLP 134 Query: 127 KLASGEWIGCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKD 186 LASGE IGCFGLTEP+ GSDP M T ARK GY L GSKMWI+N+PIAD+FVVWAK Sbjct: 135 GLASGELIGCFGLTEPDAGSDPAGMKTTARKTATGYVLNGSKMWISNAPIADLFVVWAKS 194 Query: 187 DA--GDIRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGLKGP 244 +A G IRGF+LEKG GLS P I GK+ LRASITGEIVMD V V E + P+V GLKGP Sbjct: 195 EAHGGKIRGFLLEKGTPGLSTPKIGGKLSLRASITGEIVMDGVEVAETALLPNVEGLKGP 254 Query: 245 FTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLA 304 F CLN ARYGISWG LGAAEAC ARQY LDR+QF RPLA QL Q KLA+M T+I L Sbjct: 255 FGCLNRARYGISWGVLGAAEACLSAARQYGLDRKQFNRPLAQTQLYQLKLANMMTDIALG 314 Query: 305 LQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVN 364 LQ LR+GR+ DE AA E+ SI+KR++CGKAL+ AR ARDM GGNGI ++F V RH+ N Sbjct: 315 LQASLRVGRLLDEANAAPEMISIIKRSNCGKALEAARHARDMHGGNGIQEDFHVMRHMAN 374 Query: 365 LEVVNTYEGTHDVHALILGRAQTGIQAFY 393 LE VNTYEGTHDVHALILGRA TG+QAF+ Sbjct: 375 LETVNTYEGTHDVHALILGRAITGLQAFF 403 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 403 Length adjustment: 31 Effective length of query: 362 Effective length of database: 372 Effective search space: 134664 Effective search space used: 134664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory