Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_097030669.1 CRO07_RS10610 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_900207575.1:WP_097030669.1 Length = 263 Score = 183 bits (465), Expect = 3e-51 Identities = 102/250 (40%), Positives = 152/250 (60%), Gaps = 16/250 (6%) Query: 5 QPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDI 64 +P++R++G+ K FG+V ALA + +D+ GE L+GDNGAGKST +K ++GVH+PT G + Sbjct: 10 EPILRLRGVSKQFGAVSALADIDLDIHAGEVVALVGDNGAGKSTLVKVLAGVHQPTAGTV 69 Query: 65 LFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYA 124 F G+P+ P A+ GIATV Q LA+ + V N F+G+E + P +L Sbjct: 70 EFCGRPVTLDSPSTALELGIATVFQDLALCENLDVVANLFLGHE----LAPWRL------ 119 Query: 125 NRITMEE-----MRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSAL 179 + + ME +R++ + + V +LSGG+RQTVAIAR++ ++++LDEPT+AL Sbjct: 120 DEVAMEVRAWTLLRELAARIPSVREPVASLSGGQRQTVAIARSLLLDPRIIMLDEPTAAL 179 Query: 180 GVRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEE 239 GV QTA VL I++VR +G+ V+ I+HN+ AV DR VL G+ G D S E Sbjct: 180 GVAQTAEVLNLIERVRDRGLGVIIISHNMEDVRAVADRIVVLRLGRNNGIF-TADTSNHE 238 Query: 240 LQDMMAGGQE 249 L + G E Sbjct: 239 LVAAITGATE 248 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 263 Length adjustment: 25 Effective length of query: 236 Effective length of database: 238 Effective search space: 56168 Effective search space used: 56168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory