Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate WP_097068670.1 CRO22_RS03430 3-hydroxybutyryl-CoA dehydrogenase
Query= CharProtDB::CH_091789 (282 letters) >NCBI__GCF_900217815.1:WP_097068670.1 Length = 291 Score = 306 bits (784), Expect = 3e-88 Identities = 158/280 (56%), Positives = 196/280 (70%) Query: 1 MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA 60 ++ V V+GAG MG+GIA FA GF V+L D+ E +++ + I +NL + V + KI A Sbjct: 3 IETVGVVGAGQMGNGIAHVFALSGFGVILTDVAPESLEKAMTTITRNLDRQVSREKISAA 62 Query: 61 TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLS 120 K L RI T+D++ DLVIEAA ER +K+ IF L KPETILA+NTSS+S Sbjct: 63 QKDAALGRIRTTLDISELGQTDLVIEAATERESVKQGIFDSLLPHLKPETILATNTSSIS 122 Query: 121 ITEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVA 180 IT +AS T RP+K IG+HF NP PVM+LVE+IRGIAT + T+ + +GK P Sbjct: 123 ITRLASRTDRPEKFIGVHFMNPVPVMQLVELIRGIATDEATYKELIGVIETLGKTPASAE 182 Query: 181 EAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLA 240 + P F+VNRILIPMINEAV L EG+ +V ID AMKLGANHPMGPLEL DFIGLD CLA Sbjct: 183 DFPAFIVNRILIPMINEAVYTLYEGVGNVRSIDMAMKLGANHPMGPLELADFIGLDTCLA 242 Query: 241 IMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDY 280 IM+VL+ D+KYRP LL KYV AGWLGRK+G+GFYDY Sbjct: 243 IMNVLHDGLADTKYRPCPLLTKYVEAGWLGRKTGRGFYDY 282 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 291 Length adjustment: 26 Effective length of query: 256 Effective length of database: 265 Effective search space: 67840 Effective search space used: 67840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory