Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_097070282.1 CRO22_RS11435 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_900217815.1:WP_097070282.1 Length = 289 Score = 146 bits (369), Expect = 5e-40 Identities = 91/303 (30%), Positives = 162/303 (53%), Gaps = 24/303 (7%) Query: 6 QQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGLP 65 Q I+NGL LG+ YALIALG T+++ ++N++NFAHG + ++G + ++ V Q P + Sbjct: 3 QIIVNGLFLGASYALIALGLTLIFSLMNVLNFAHGQMYVLGGFITYTV--VAQFHLPFVV 60 Query: 66 GIVQLVIAIVGAIPVCIVVSLLIERIAYRPL--RNAPRLAPLITAIGVSILLQTLAMMIW 123 G++ +A+ + ER + P+ R+ + ++ A G++ L + ++++ Sbjct: 61 GLICSAVALA-------ALGAFAERFLFAPVIRRSKREESTMLLAAGIAFFLDAVTLLVF 113 Query: 124 GRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRATAEN 183 G P+++ ++ +I++ LAV + +L + ++ GRAMRA A++ Sbjct: 114 GEKQRGIPKIVQGVFNWDFRIVMPYDRILIGCLAVALIAAFILFMRLSRTGRAMRALAQD 173 Query: 184 PRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVLGG 243 A LMGVD + ++ FA+GA LA + G + + MG +KAF ++GG Sbjct: 174 RMAAELMGVDVGRYSMIGFALGAMLAGLVGGL-LVSIVGVNLGMGGPTSIKAFMMIMIGG 232 Query: 244 IGNIYGAMLGGILLGLIESLGAGYI---GDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGI 300 G I GA+ GG +LG++ES+G + GD+T + F+ L+I L RP G+ Sbjct: 233 AGVISGAIAGGFILGMLESVGLSLLAAYGDIT---------YLVIFVSLLIFLAFRPQGL 283 Query: 301 MGE 303 MG+ Sbjct: 284 MGK 286 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 289 Length adjustment: 27 Effective length of query: 282 Effective length of database: 262 Effective search space: 73884 Effective search space used: 73884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory