Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_097141823.1 CRO48_RS21035 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_900220975.1:WP_097141823.1 Length = 343 Score = 193 bits (490), Expect = 6e-54 Identities = 122/323 (37%), Positives = 175/323 (54%), Gaps = 3/323 (0%) Query: 9 LLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLRLPRSLVAV 68 +LW VAA++++ + V+ AD A+ G T+ +A V +R+PR+L+A+ Sbjct: 19 MLWLAVVAAVLVLLCILSVAIGTREVAWADIVAAI-GGREDTIAQAAVA-MRIPRTLLAL 76 Query: 69 LIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYSLSFIAACG 128 L GA+L LAG ++Q +T NP+A P +LG+N GA+LA+ + A A + F A G Sbjct: 77 LAGAALGLAGAIMQGVTRNPLADPGILGVNMGASLAVVVGVAWFNIASADAYI-FAAVLG 135 Query: 129 GGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAYGIFYWLAGG 188 G S + V G R KL LAG A S L +L D A GI W GG Sbjct: 136 AGASAVFVYAIGSLGRGGATPLKLALAGAATSVAFSSLVIALVLPRNDIAGGIRAWQIGG 195 Query: 189 VSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLVLL 248 V A ++ + +LP +V + LL A +LN L L D A LG + R +L Sbjct: 196 VGGATFERMSHVLPFLVAGFIISLLSARKLNSLALGDDLAAGLGERVALARAFAAFGAIL 255 Query: 249 LVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAFPG 308 L GA +V GP+ F+GL+VPHL R G D R +LP S + GA L+L AD++ R +A P Sbjct: 256 LCGATTAVCGPIGFLGLVVPHLCRLLVGVDHRWLLPFSAVAGACLLLGADIVGRIIARPA 315 Query: 309 DLPAGAVLALIGSPCFVWLVRRR 331 +L G V A +G+P F+W+VRR+ Sbjct: 316 ELDVGIVTAFVGAPFFIWVVRRQ 338 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 343 Length adjustment: 28 Effective length of query: 304 Effective length of database: 315 Effective search space: 95760 Effective search space used: 95760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory