A0A662Z298 has 5134 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-24 70.2 4.7 4.4e-24 70.2 4.7 3.1 3 A0A662Z298
Domain annotation for each sequence (and alignments):
>> A0A662Z298
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 5.9 0.0 0.00052 0.00052 6 22 .. 1966 1982 .. 1961 1983 .. 0.86
2 ? -5.2 1.9 1 1 30 41 .. 3878 3889 .. 3861 3893 .. 0.61
3 ! 70.2 4.7 4.4e-24 4.4e-24 2 53 .. 4426 4477 .. 4423 4478 .. 0.94
Alignments for each domain:
== domain 1 score: 5.9 bits; conditional E-value: 0.00052
ZnF_RZ-type 6 kgtghwYkCpnGHpYvi 22
+g+++kC n H Yv+
A0A662Z298 1966 DAEGKMWKCSNRHLYVV 1982
55799***********9 PP
== domain 2 score: -5.2 bits; conditional E-value: 1
ZnF_RZ-type 30 eesrCpeCgatI 41
+ Cp C+ I
A0A662Z298 3878 AQMYCPVCKTAI 3889
455699999887 PP
== domain 3 score: 70.2 bits; conditional E-value: 4.4e-24
ZnF_RZ-type 2 akafkgtghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
a+++ g+ hwY CpnGHp+++geCG++me+ +C +Cga+ GGe+h +++g++
A0A662Z298 4426 AQQVLGQVHWYVCPNGHPCAVGECGQPMERRKCIDCGAEMGGENHVPVQGFK 4477
5677889******************************************986 PP
Or compare A0A662Z298 to CDD or PaperBLAST