PaperBLAST – Find papers about a protein or its homologs

 

Align A0A662Z298 to PF20173 (ZnF_RZ-type)

A0A662Z298 has 5134 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.3
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.4e-24   70.2   4.7    4.4e-24   70.2   4.7    3.1  3  A0A662Z298  


Domain annotation for each sequence (and alignments):
>> A0A662Z298  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    5.9   0.0   0.00052   0.00052       6      22 ..    1966    1982 ..    1961    1983 .. 0.86
   2 ?   -5.2   1.9         1         1      30      41 ..    3878    3889 ..    3861    3893 .. 0.61
   3 !   70.2   4.7   4.4e-24   4.4e-24       2      53 ..    4426    4477 ..    4423    4478 .. 0.94

  Alignments for each domain:
  == domain 1  score: 5.9 bits;  conditional E-value: 0.00052
  ZnF_RZ-type    6 kgtghwYkCpnGHpYvi 22  
                     +g+++kC n H Yv+
   A0A662Z298 1966 DAEGKMWKCSNRHLYVV 1982
                   55799***********9 PP

  == domain 2  score: -5.2 bits;  conditional E-value: 1
  ZnF_RZ-type   30 eesrCpeCgatI 41  
                    +  Cp C+  I
   A0A662Z298 3878 AQMYCPVCKTAI 3889
                   455699999887 PP

  == domain 3  score: 70.2 bits;  conditional E-value: 4.4e-24
  ZnF_RZ-type    2 akafkgtghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53  
                   a+++ g+ hwY CpnGHp+++geCG++me+ +C +Cga+ GGe+h +++g++
   A0A662Z298 4426 AQQVLGQVHWYVCPNGHPCAVGECGQPMERRKCIDCGAEMGGENHVPVQGFK 4477
                   5677889******************************************986 PP



Or compare A0A662Z298 to CDD or PaperBLAST