A4IFB0 has 541 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-20 59.9 0.0 2.4e-20 59.2 0.0 1.4 1 A4IFB0 Domain annotation for each sequence (and alignments): >> A4IFB0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.2 0.0 2.4e-20 2.4e-20 7 133 .. 312 437 .. 306 443 .. 0.87 Alignments for each domain: == domain 1 score: 59.2 bits; conditional E-value: 2.4e-20 HHTSSSEEEE---TTTTSS-SS--SSEEE--S--HHHHG..GG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--TTT CS EryCIII-like_C 7 lgevDaeivvtldararedlaslPdnvRlvdfvPlgvlL..ptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpkde 99 lg++ + ++ + ++ + ++l +n Rl++++P +lL + +a++ hGG s + +GvP + +p + D+ rv++ G Gi l+ ++ A4IFB0 312 LGRLPQKVIWRF---SGTKPKNLGNNTRLIEWLPQNDLLghSNIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMIRVQAKGMGILLEWKT 403 555666666654...3445568889**************444789************************************************** PP --HHHHHHHHHHHHH-HHHHHHHHHHHHHHHTS- CS EryCIII-like_C 100 ldadslaeavarvledpayreaaaklaeealaeP 133 ++ +l ea+ +v+++p+yr+ a+kl e +P A4IFB0 404 VTEGELYEALVKVINNPSYRQRAQKLSEIHKDQP 437 **************************98766666 PP
Or compare A4IFB0 to CDD or PaperBLAST