A6T4W7 has 128 amino acids
Query: DUF3461 [M=125] Accession: PF11944.12 Description: Protein of unknown function (DUF3461) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-60 187.0 2.3 7e-60 186.9 2.3 1.0 1 A6T4W7 Domain annotation for each sequence (and alignments): >> A6T4W7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 186.9 2.3 7e-60 7e-60 1 125 [] 1 125 [. 1 125 [. 1.00 Alignments for each domain: == domain 1 score: 186.9 bits; conditional E-value: 7e-60 DUF3461 1 myehLksigitepdeierytLrqeaeadiLkiyfkkekgellaksvkfkfprqrkkilvdsgseeyknvseinatLrqvldeLdkltekekaeadikkklLe 102 my++Lks+git+pdei+ry+Lrqea++diLkiyf+k+kge++aksvkfk+prqrk++ d + yk+v+ei+++Lr+v+deLd++ +++++e d+k+k+L+ A6T4W7 1 MYDNLKSLGITNPDEIDRYSLRQEANNDILKIYFQKDKGEFFAKSVKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYVIDELDQICQRDRTEIDLKRKILD 102 9***************************************************************************************************** PP DUF3461 103 dlkhlervvqdkikeierdlekl 125 dl+hle+vv++ki+eie+dlekl A6T4W7 103 DLRHLESVVTNKISEIEADLEKL 125 *********************97 PP
Or compare A6T4W7 to CDD or PaperBLAST