A6T7L3 has 168 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-54 169.8 0.6 2.8e-54 169.6 0.6 1.0 1 A6T7L3 Domain annotation for each sequence (and alignments): >> A6T7L3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.6 0.6 2.8e-54 2.8e-54 4 158 .. 5 156 .. 2 157 .. 0.99 Alignments for each domain: == domain 1 score: 169.6 bits; conditional E-value: 2.8e-54 DUF892 4 elfideLrDayaaEkqalkalpkmakaaes.peLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkdaaliaaaqav 105 e+++d+LrDa+a+Ekqa+++l++ma ++++ p+L+a++eqH++eT++qi+ le+++ r + + s +k d m++++a gq++++++ +de+vk+ + +++++ A6T7L3 5 EHYHDWLRDAHAMEKQAESMLESMAGRIDNyPDLRARIEQHVNETKRQITVLEEILDRNEISRSVIK-DSMSKMAALGQSIGGMFPSDEIVKGSI---SGYVF 103 89*****************************************************************.***************************...***** PP DUF892 106 ehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 e++Eia+Y++L+a+Ae++g++ ++e++l+eE++++++L ++++++++q++ A6T7L3 104 EQFEIACYTSLLAAAEKAGDTASIPAIEAILAEEREMADWLIKHIPQTTEQFL 156 *************************************************9986 PP
Or compare A6T7L3 to CDD or PaperBLAST