A6T9R7 has 68 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-27 80.5 1.5 3.7e-27 80.4 1.5 1.0 1 A6T9R7
Domain annotation for each sequence (and alignments):
>> A6T9R7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.4 1.5 3.7e-27 3.7e-27 1 49 [] 18 66 .. 18 66 .. 0.98
Alignments for each domain:
== domain 1 score: 80.4 bits; conditional E-value: 3.7e-27
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
+yv+tTk+Gqtivt+gkP+lDk+tGm++Y de+G++++In++dV+q e
A6T9R7 18 NYVMTTKSGQTIVTHGKPQLDKETGMTSYIDESGNKREINSSDVSQLVE 66
7*********************************************876 PP
Or compare A6T9R7 to CDD or PaperBLAST