A6TET8 has 152 amino acids
Query: DUF494 [M=153] Accession: PF04361.17 Description: Protein of unknown function (DUF494) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-59 186.4 4.1 1.7e-59 186.3 4.1 1.0 1 A6TET8 Domain annotation for each sequence (and alignments): >> A6TET8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 186.3 4.1 1.7e-59 1.7e-59 6 153 .] 1 152 [] 1 152 [] 0.98 Alignments for each domain: == domain 1 score: 186.3 bits; conditional E-value: 1.7e-59 DUF494 6 vYLfenyi..eaealpdedeLeeeLsaaGFeeeeIkkAldwleeLaalqeeeeeaal..aessslRiyteeEqekLdaeargfllfLeqagvldaetrElvid 104 +YLfe+yi eae+++d+d+L+++L++aGFe+e+I++Al wle+La+ qe e+++ +++ slR+yteeE+++Lda +rgfllfLeq++vl+ etrE+vi+ A6TET8 1 MYLFETYIhsEAEMRVDQDKLTRDLTDAGFEREDIYNALMWLEKLADYQEGLVEPMQlaSDPLSLRVYTEEECQRLDASCRGFLLFLEQIQVLNLETREMVIE 103 8*******999999*************************************999988888999**************************************** PP DUF494 105 ramaldeeeisledlkwvvlmvlfnqpgeekallileellldeeeellh 153 r++ald++e++ledlkwv+lmvlfn pg e+a++++eell++ +e++lh A6TET8 104 RVLALDTAEFELEDLKWVILMVLFNIPGCENAYQQMEELLFEVNEGMLH 152 ********************************************99998 PP
Or compare A6TET8 to CDD or PaperBLAST