B2JYH9 has 182 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-15 42.1 0.0 1e-14 41.1 0.0 1.5 1 B2JYH9
Domain annotation for each sequence (and alignments):
>> B2JYH9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 41.1 0.0 1e-14 1e-14 11 79 .] 27 95 .. 26 95 .. 0.97
Alignments for each domain:
== domain 1 score: 41.1 bits; conditional E-value: 1e-14
CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
l++ +a R++ a+++a K ++g+pv+d +Re++v+++++ a+e+gl +e + +if + +++ +++Q+
B2JYH9 27 LVRSMADRLNTADQVALSKWDTGQPVYDGQREAQVIANAATMASEYGLTAEDAINIFSDQVEANKEVQY 95
78999*************************************************************996 PP
Or compare B2JYH9 to CDD or PaperBLAST