PaperBLAST – Find papers about a protein or its homologs

 

Align B5XUP5 to PF06004 (DUF903)

B5XUP5 has 72 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.3e-28   84.2   4.3    2.6e-28   84.0   4.3    1.1  1  B5XUP5    


Domain annotation for each sequence (and alignments):
>> B5XUP5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.0   4.3   2.6e-28   2.6e-28       1      48 [.      23      70 ..      23      71 .. 0.98

  Alignments for each domain:
  == domain 1  score: 84.0 bits;  conditional E-value: 2.6e-28
  DUF903  1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
            +yv++TkDG++i+t+gkP +D+dtG+++Yed++G+++qIn+ddV+qI+
  B5XUP5 23 DYVMATKDGRMILTDGKPTVDDDTGLISYEDQQGNKMQINRDDVSQII 70
            6**********************************************8 PP



Or compare B5XUP5 to CDD or PaperBLAST