B7GCM8 has 722 amino acids
Query: DUF202 [M=68]
Accession: PF02656.19
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.6e-16 45.1 2.5 9.8e-16 44.3 2.5 1.4 1 B7GCM8
Domain annotation for each sequence (and alignments):
>> B7GCM8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.3 2.5 9.8e-16 9.8e-16 1 66 [. 613 677 .. 613 679 .. 0.93
Alignments for each domain:
== domain 1 score: 44.3 bits; conditional E-value: 9.8e-16
DUF202 1 rdglAnERTfLaWlRtslalialgvallrffleggptalalilglilivlgiltlllalvrylrre 66
++++AnERTfL Wl+ ++ l +++ ++l f +e g ++ +++ +l+l+ +++ + ++a++ +l+r+
B7GCM8 613 KVFFANERTFLHWLHHGVILSTIASGILSFSHETGAGW-GQWYALALLPISLSFCVYAVHIFLWRA 677
689**************************987777777.9************************97 PP
Or compare B7GCM8 to CDD or PaperBLAST