B7PYR4 has 924 amino acids
Query: DUF3504 [M=162] Accession: PF12012.12 Description: Domain of unknown function (DUF3504) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-36 112.1 1.4 2.4e-24 72.4 0.2 2.6 2 B7PYR4 Domain annotation for each sequence (and alignments): >> B7PYR4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.4 0.2 2.4e-24 2.4e-24 4 65 .. 798 859 .. 796 863 .. 0.93 2 ! 38.4 0.1 6.9e-14 6.9e-14 116 160 .. 863 907 .. 859 909 .. 0.92 Alignments for each domain: == domain 1 score: 72.4 bits; conditional E-value: 2.4e-24 DUF3504 4 rveEeeLWeskqLgadsPivLLntllyfntkyfnlrtveehlkLsfsnverqskknpreket 65 r++E LW++kqLga+sP+vLLntl+yfn + f+l+tve+hlkLsf+nv++q++k p++++t B7PYR4 798 RISEAVLWDAKQLGAHSPLVLLNTLMYFNIRDFHLHTVEDHLKLSFTNVTKQWQKGPKAQST 859 689****************************************************9996665 PP == domain 2 score: 38.4 bits; conditional E-value: 6.9e-14 DUF3504 116 cPesvkerkdvFYlqpeksvvpesplWyssqplgkesLesmlkri 160 P+ +k r dv+Y++p++++ p+sp+Wyss p+gk+++++ml+r B7PYR4 863 SPDLTKCRPDVYYMTPDRQCLPDSPTWYSSLPVGKDTMAKMLTRF 907 57778889***********************************96 PP
Or compare B7PYR4 to CDD or PaperBLAST