B8F381 has 348 amino acids
Query: DUF697 [M=162] Accession: PF05128.16 Description: Domain of unknown function (DUF697) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-57 179.0 0.6 3e-56 175.8 0.6 2.1 2 B8F381 Domain annotation for each sequence (and alignments): >> B8F381 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.7 0.0 0.021 0.021 71 96 .. 137 162 .. 133 170 .. 0.76 2 ! 175.8 0.6 3e-56 3e-56 2 160 .. 173 330 .. 172 332 .. 0.98 Alignments for each domain: == domain 1 score: 0.7 bits; conditional E-value: 0.021 DUF697 71 yesairLarsvlanlaalGavelgtd 96 e+a++ +sv++nla + +v+ + + B8F381 137 GEKAREFCKSVVKNLAQTPMVQQVEQ 162 57788999999999999988887665 PP == domain 2 score: 175.8 bits; conditional E-value: 3e-56 DUF697 2 qaaellelaeqelleqrdreakkliekyawekAlvvavsPlalvDllavaavnlrmirelaelYgielgyesairLarsvlanlaalGavelgtdllkqllsl 104 +++e+l l+++++l++ d++ kkli+k a+e+A++vavsPlalvD+l+va++n+++++++ + Yg+elgy s+++L+r+v++n++++Ga+e+++d++ +++s+ B8F381 173 NSKEVLYLFSENVLSPIDNQVKKLISKNAAENAIIVAVSPLALVDILMVAWRNIALVNKITKAYGMELGYISRLKLFRMVMTNMVFAGATEIASDVGLDFFSQ 275 7899*************************************************************************************************** PP DUF697 105 nlatklsaraaQGvvagllTarvGlsaieyfrplpswgdegkpklsevvkellsql 160 nl+++ls+raaQG++ gllTar+G++a+e++rp ++++++pkls v++el+ l B8F381 276 NLTARLSVRAAQGIGMGLLTARLGIKAMEFCRPVV-FQQNERPKLSVVRQELIGVL 330 ***********************************.***************98765 PP
Or compare B8F381 to CDD or PaperBLAST