BRENDA::A0A0K1E2F9 has 210 amino acids
Query: CTP-dep_RFKase [M=121] Accession: PF01982.20 Description: Domain of unknown function DUF120 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-50 154.5 0.0 8.2e-50 154.1 0.0 1.2 1 BRENDA::A0A0K1E2F9 Domain annotation for each sequence (and alignments): >> BRENDA::A0A0K1E2F9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 154.1 0.0 8.2e-50 8.2e-50 1 121 [] 88 208 .. 88 208 .. 0.99 Alignments for each domain: == domain 1 score: 154.1 bits; conditional E-value: 8.2e-50 CTP-dep_RFKase 1 VvsGlgeGkyyvslegykeqfeeklgfePypGTLNvkldeeslelrkaleklkgieiegfeeeertfgevkaypakiegieaavvvperth 91 VvsGlgeG++y+slegy++ +ee lgf PypGTLNvkld +sl r+ le+l+gi i+gf+++ rt+g+vka++a+i+g+e+avv+perth BRENDA::A0A0K1E2F9 88 VVSGLGEGAFYISLEGYRRVMEELLGFVPYPGTLNVKLDPQSLPYRRYLESLPGILIPGFTNGMRTYGAVKAFRARIRGVEGAVVMPERTH 178 89***************************************************************************************** PP CTP-dep_RFKase 92 ypedvlEiiapvkLReklelkdgdeveiev 121 +p+dv+E++a+vkLR+ l+l+dgd+veie+ BRENDA::A0A0K1E2F9 179 HPTDVIEVVASVKLRDVLGLRDGDKVEIEI 208 ****************************97 PP
Or compare BRENDA::A0A0K1E2F9 to CDD or PaperBLAST