BRENDA::A8AAX2 has 348 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-24 72.0 1.4 2.1e-24 72.0 1.4 2.1 2 BRENDA::A8AAX2 Domain annotation for each sequence (and alignments): >> BRENDA::A8AAX2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.0 1.4 2.1e-24 2.1e-24 1 78 [. 13 90 .. 13 91 .. 0.99 2 ? -1.6 0.1 0.2 0.2 35 53 .. 305 324 .. 296 338 .. 0.59 Alignments for each domain: == domain 1 score: 72.0 bits; conditional E-value: 2.1e-24 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78 R+e+d++D+e+l+Ll++R+e++kei Kk+ glpv+d++Reeev+ ++ + elg+++e+++++f+ i++es+++Q BRENDA::A8AAX2 13 RRELDKLDKEILRLLKRRFEIVKEITDTKKNLGLPVYDRDREEEVMVTRTVWGLELGIPQEFTKEMFKMILEESKKIQ 90 99*************************************************999**********************99 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CM_2 35 pvldpeReeevlerlre.ga 53 ++ + + ev+++++e ++ BRENDA::A8AAX2 305 TIQRLKELSEVIDEIQEmNE 324 56666666777777777433 PP
Or compare BRENDA::A8AAX2 to CDD or PaperBLAST