BRENDA::B6C761 has 286 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.2e-13 35.3 0.0 1.4e-12 34.2 0.0 1.5 1 BRENDA::B6C761
Domain annotation for each sequence (and alignments):
>> BRENDA::B6C761
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 34.2 0.0 1.4e-12 1.4e-12 11 79 .] 111 179 .. 110 179 .. 0.95
Alignments for each domain:
== domain 1 score: 34.2 bits; conditional E-value: 1.4e-12
CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
++ + ++R+ lak++ yK n++++ d eRe+ vl+++ ++a+++g+++++ e +f++ +++ + +Qk
BRENDA::B6C761 111 IVGMANKRLMLAKDVVLYKYINNNSIDDFEREKVVLQNVLAQAKSAGISDNYGEPFFQDQMDANKVIQK 179
677789*********************************************************998885 PP
Or compare BRENDA::B6C761 to CDD or PaperBLAST