BRENDA::C7EXK8 has 386 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-23 66.8 2.0 2.2e-22 65.6 2.0 1.7 1 BRENDA::C7EXK8 Domain annotation for each sequence (and alignments): >> BRENDA::C7EXK8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.6 2.0 2.2e-22 2.2e-22 1 79 [] 11 89 .. 11 89 .. 0.98 Alignments for each domain: == domain 1 score: 65.6 bits; conditional E-value: 2.2e-22 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 R++I ++D++ll+LlaeR ela e++++K ++ pv+d +Re+++lerl ++++ld+++++++f+ ii+ s+ Q+ BRENDA::C7EXK8 11 REKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDSVLTQQ 89 99****************************9999*****************9999*******************99985 PP
Or compare BRENDA::C7EXK8 to CDD or PaperBLAST