BRENDA::O52711 has 376 amino acids
Query: UPF0020 [M=197] Accession: PF01170.24 Description: RMKL-like, methyltransferase domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-13 34.8 0.0 1.5e-10 27.2 0.0 2.2 2 BRENDA::O52711 Domain annotation for each sequence (and alignments): >> BRENDA::O52711 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.2 0.0 1.5e-10 1.5e-10 6 54 .. 38 85 .. 35 142 .. 0.81 2 ! 5.5 0.0 0.00065 0.00065 109 133 .. 235 261 .. 211 270 .. 0.83 Alignments for each domain: == domain 1 score: 27.2 bits; conditional E-value: 1.5e-10 UPF0020 6 fngpapLketLAaalvrlagwkdgepllDPmCGsGtilIEaallgania 54 + ++++Lk++LA lv+ + g + lDPm G Gti+ Eaal g+ + BRENDA::O52711 38 CSYQGKLKPSLAHWLVKTFSPE-GGTVLDPMGGVGTIAFEAALTGRVGI 85 56899***********988775.66788***************997655 PP == domain 2 score: 5.5 bits; conditional E-value: 0.00065 UPF0020 109 qadaakLr.lkegevdvivtnpPY.Ge 133 + d+++L + ++ vd+i+t pP+ G BRENDA::O52711 235 EGDFRDLSeHINEPVDAIITSPPFmGM 261 67999999767889*********9555 PP
Or compare BRENDA::O52711 to CDD or PaperBLAST